PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462857098
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family B3
Protein Properties Length: 343aa    MW: 38862.4 Da    PI: 8.7082
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462857098genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B348.21.9e-1596179190
                EEEE-..-HHHHTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
         B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                ffkv+ p  + ++ r+ +p +f  ++ +++++++  ++l+ +sg++W+v l  +   ++  +t+GWkeFv ++ ++ g +++F++dg+sef
  462857098  96 FFKVFFP--HQSRERFEIPHPFY-KYlEEEPNRP--VSLKGPSGNTWQVML--TSVEEGLGFTQGWKEFVGDHSIQPGYILMFTYDGHSEF 179
                7888855..4556679*******.5548777776..***************..99999999*************************99888 PP

2B355.69.4e-18238328397
                EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
         B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                +v++ s+      + +p +f++++    +++k++tl d++g+ Wev++ +++ ++   +++GW +F+  n+L+  D++vF+l ++++   +v+++
  462857098 238 QVMMASYIYVGFFMNIPCEFVRQYLP--QSGKKMTLWDPQGKPWEVQYMFNNEGSNAGFSGGWGKFAAGNNLENLDVCVFELLKEDN--IKVHIY 328
                56788888888899**********53..47789*****************999999*************************987444..477776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.106.5E-1994183IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.2194187IPR003340B3 DNA binding domain
SuperFamilySSF1019364.51E-1895182IPR015300DNA-binding pseudobarrel domain
CDDcd100171.36E-1495181No hitNo description
PfamPF023623.0E-1396180IPR003340B3 DNA binding domain
SMARTSM010195.3E-1296187IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.6E-25228329IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019369.42E-25229329IPR015300DNA-binding pseudobarrel domain
CDDcd100174.86E-24234329No hitNo description
PROSITE profilePS5086313.69236331IPR003340B3 DNA binding domain
SMARTSM010191.7E-13236331IPR003340B3 DNA binding domain
PfamPF023628.0E-16238329IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MPPPTAAPSN GACRRRCVLA LALSPLLRAP CSSSCMGERD VSCATIDFRD VVSREKQQDI  60
SSAAAAAEER SMRKGKESGM EKQKEKGDAV GADQHFFKVF FPHQSRERFE IPHPFYKYLE  120
EEPNRPVSLK GPSGNTWQVM LTSVEEGLGF TQGWKEFVGD HSIQPGYILM FTYDGHSEFS  180
VNKSETRSRN VPRVGKVVSK KLRQPVVISQ RHRITEEEKA HALKRANEFK SNNPFTLQVM  240
MASYIYVGFF MNIPCEFVRQ YLPQSGKKMT LWDPQGKPWE VQYMFNNEGS NAGFSGGWGK  300
FAAGNNLENL DVCVFELLKE DNIKVHIYRI VPEITQLLCN KSM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A1e-1320933022142B3 domain-containing transcription factor VRN
4i1k_B1e-1320933022142B3 domain-containing transcription factor VRN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978926.15e-73PREDICTED: B3 domain-containing protein Os11g0197600-like
SwissprotQ2R9D21e-68Y1176_ORYSJ; B3 domain-containing protein Os11g0197600
TrEMBLK3ZLC32e-74K3ZLC3_SETIT; Uncharacterized protein
STRINGSi027380m6e-74(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44613766
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42700.14e-17B3 family protein